GenomeNet

>nvi:100122545 glutamate decarboxylase-like protein 1-like; K01580 glutamate decarboxylase [EC:4.1.1.15] (A)
MPAHEETQLQEGSAIEALERPRSADSEKHSRLDYEREEEAHQIGEDSDEGYAMDNFNEEG
FFCSLPGRESHEKFIRDAVEMILREAVFKGTSRKNRVVEWIEPATLPSKIDLPPRKTGES
HEALLRLLDSVIRYSVKTGHPHFVNQLYSSVDPYGLVGQWLTDALNPSVYTYEVSPVFSL
MEEAVLKEMRAIVGWQNGEGDGIFCPGGSMANGYAINLARHWMFPIVKEQGLTAVPRLVV
FTSEDAHYSVKKLAAFLGIGIANVYSVKVDESGKMCVSDLRAQIDRAIQEGARPLMVSAT
AGTTVLGAFDPLRSIAELCREHNMWFHVDAAWGGGALVSPKHRHLLDGVELADSVTWNPH
KLLAAPQQCSTLLTRHKGLLQSAHGCKATYLFQQDKFYDTSYDFGDKHVQCGRRADVLKF
WLMWKAKGTDGLEKHVDRVFQLSRYFVGIIRNRPGWQLLFEPECTNVCFRYVPPSKRHLN
GQDLFQALHKVAPLVKERMVKTGSMLITYQPIREQANFFRLVLQNSGLTEADMHFFVEEI
ERLSEDL

BLAST