GenomeNet

>nwi:Nwi_0353 ATP-dependent DNA ligase LigD polymerase module / ATP-dependent DNA ligase LigD phosphoesterase module (EC:6.5.1.1); K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MPSRKLSTYRNKRDFSKTAEPSGGARIAPARQRRFVIQKHDATRLHYDFRLEYDGVFKSW
AVTRGPSLDPAVKRLAVEVEDHPLDYGDFEGTIPKGQYGGGTVAIWDRGYWYADDPAKGL
AKGDLKFALMGEKLRGEWVLVRMKNDRSGGKRTNWLLIKHRDDYARPGDGEDVLKQDRSV
ASNRTLEQIAEGKGKAPEPFMMTRRIAGSDAVWDSNKGVAARARARAERRPAKASAQPAS
TGKTTLKESRPQTARAHAIKSKMPDFAGLQLCEAATRPPSADSWVHEIKLDGYRIQMRIE
SGAVTLRTRKGLDWTDRFPAIAKAAAKLPDALIDGEIVALNANGDPDFPAMQAALAEGRT
DALVYFAFDLLFTEGEDLRPLPLLARKDQLRKLLGRSAKSNRATIRYVEHFDVDGEQMLA
TARESGLEGIISKRIDAAYRAGRRGSWLKTKSRPGHEVVIGGWKTTGDKFRSLMAGVHNG
DRLVYTGIVGTGYGRDTVKRIMPALKAAAASKSPFSGKNAPAGGRDVHWLKPELVAEIEF
AGWTDDGMVRQAAFKGLRADKPAREVTAEMPTRAAALKLDKARPKATRPGTRAAAAARSD
PTTSRQSRTSAARDRSTVMGVAISHPDKALWPDAGDKRPVTKHDLAAYMEAVGGWMIGHI
RGRPCSIVRAPDGIHSETFFQRHAMPGLSDLVTQAKVSDDRKPYLQIDRVEALAAVAQIG
GIELHPWNCAPDEYTVPGRLVFDLDPAPDVAFPDVIAAAREMRQRLEALKLESFCKTTGG
KGLHVVTPLAIGPKDGLNWKQAKMFAQAVCEQMAADAPDKYLINMSKKQREGKIFLDYLR
NDTKSTAVAPLSPRARPGATVSMPLNWAQVKTGLDPKRFTLRTAPDLLKKSKAWADYDSA
ARPLAAAIGRLVR

BLAST