GenomeNet

>oaa:100074981 TGM2; protein-glutamine gamma-glutamyltransferase 2; K05625 transglutaminase 2 [EC:2.3.2.13] (A)
FPFAGPEPSTETGTKARFALSAEEPVGCWSAFLMNQDDASLSVALCSPPDAPVGQYQLTL
ETDIGTQGSRFPAGKFILLFNTWCSEDSVYLDDEREREEYVLSQYGIIYQGSHKFINPTH
WNFGQNAAGRPFPRLWFQINSNDEDHGVLLGRWKEPYEDGTNPNFWTGSVAILRKWMESG
SQQVRYGQCWVFAAVACTVLRALGIPTRVVTNFNSAHDTDRNLVIDIYYDASGQRLEGQR
DSIWSVALFRPRVFFARVSLAGSSEEREAFRKADRQLEEPEPERAGLSVRIKGSEHMDKG
SDFDVSALVTNGTDGDLSARLLLCARTVSYNGILGPPCGFVDLRDFSLPARNDQTVPLRI
RYHDYSPYLTESNLIKVMALVTEPQSDSYLMAERDIYLKNPDIRIRILGEPKQYEKLVAE
VSLKNPLETPLLDCCFTLEGAGLTLGQQVIHLAAPLRGLVGGGEHYARNSVLSPRGESQT
DGVITVTEELTIPEKSGSP

BLAST