GenomeNet

>oaa:100075994 protein Wnt-7a-like; K00572 wingless-type MMTV integration site family, member 7 (A)
MAFRGRRGTLGGPGAPRGERVGGSDGEGTMDEGEEAGTLSTWAARSRSGASKKEKTCRRP
SNESDPIVTDELARSLTRTLLPSFRFPRARPPPPPSALYSPRQGELLPSRPGIRLVRRTR
KGGAGRRVRAGSGTDQYPLRFCKAGARGAIPCRPGHAGLPRKIPPRYPLPPCSLAGRSRA
TLLSTLARCRLNWGFSSVVALGASVICNKIPGLAPRQRAICQSRPDAIIVIGEGSQMGIN
ECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAITAACTQGNLSDC
GCDKEKQGQYHKEEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLMNLHNNEAGRKI
LEENMKLECKCHGVSGSCTTKTCWTTLPKFRELGYILKDKYNEAVHVEPVRASRNKRPTF
LKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRMCNKTALQSNGCDLMCCGR
GYNTHQYSRVWQCNCKFHWCCYVKCNTCSERTEVYTCK

BLAST