GenomeNet

>oaa:100082097 K00933 creatine kinase [EC:2.7.3.2] | (RefSeq) CKM; creatine kinase M-type (A)
MPFGNTHNKYKLNFKPEEEFPDLTKHNNHMAKVLTPDLYKKLRDKETPSGFTLDDIIQTG
VDNPGEPPRPHPPAPRPRPDPRRPAPPCPGVGGKYYPLKSMTEQEQQQLIDDHFLFDKPV
SPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQ
KIEEIFKKAGHPFMWNEHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQ
KRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIP
AQK

BLAST