GenomeNet

>oaa:100082097 CKM; creatine kinase, muscle; K00933 creatine kinase [EC:2.7.3.2] (A)
MPFGNTHNKYKLNFKPEEEFPDLTKHNNHMAKVLTPDLYKKLRDKETPSGFTLDDIIQTG
VDNPGEPPRPHPPAPRPRPDPRRPAPPCPGVGGKYYPLKSMTEQEQQQLIDDHFLFDKPV
SPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQ
KIEEIFKKAGHPFMWNEHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQ
KRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIP
AQK

BLAST