GenomeNet

>oaa:100083131 SDHA; succinate dehydrogenase complex, subunit A, flavoprotein (Fp); K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] (A)
MSLLNFIKTYHLHKTFSEAHEFRYLHLVNLMISIFVFQKWPAAFQSVSRNFHLNVDGNKR
ASAKVSDSISTQYPVVDHEYDAVVVGAGGAGLRAAFGLSEAGFKTACLTKLFPTRSHTVA
AQGGINAALGNMEEDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSR
TEEGKIYQRAFGGQSLQFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFAL
DLLMENGECRGVIALCIEDGSIHRIRAKNTVVATGGYGRTFFSCTSAHTSTGDGTAMITR
AGLPCQDLEFVQFHPTGIYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDV
VSRSMTIEIREGRGCGPEKDHVYLQLHHLPPEQLASRLPGISETAMIFAGVDVTKEPIPV
LPTVHYNMGGIPTNYKGQVLKHVNGKDQVVPGLYACGEAASASVHGANRLGANSLLDLVV
FGRACALSIAESCRPGDAVPSIKANAGEESVANLDRLRFANGSIRTSELRLNMQKSMQNH
AAVFRVGSVLQEGCEKISQLYGDLKNLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGA
EARKESRGAHAREDYKVRVDEYDFSKPIQGQQKRPFEEHWRKHTLSYVDTKTGKVTLEYR
PVIDKTLNEADCATVPPAIRSY

BLAST