GenomeNet

>oaa:100087250 MAPK6; mitogen-activated protein kinase 6; K06855 mitogen-activated protein kinase 4/6 [EC:2.7.11.24] (A)
MDYLTCGDFTLKAVADPKNKMKVPFVEAIAAVFDAVETLDFLEQILTFSPMDRLTAEEAL
SHPYMSIYSFPTDEPISSHPFHIEDEVDDILLMDETHSHIYNWERYHESEFSEHDWPLHN
NYDIDEVQRDPRALSDVTDEEEVQVDPRKYLDGDREKYLEDPAFDTHYSTEPCWPYPDHH
ENKYCDLECSHTCNYKMRSSSYLDNLVWRESEVNHYYEPKLIIDLSNWKEQSKEKSDKKG
KSKCERNGLVKAQIALEEASQQLVEKEREKNQGFDFDSFIAGTIQLSLQHESTDVDKLND
LNSSVSQLEPKGLLSKSVSREKQEKGMANLAQLEALYQSSWDSQFGSGGAECFLIDQFCC
EVRKDEHIEKENTYTSYLDKFLRQKEDAEMLEMEPADDGKLGEKESEEGFPDNSGEFLFN
KQLESIGIPQFHSPVGSPLKSIQATLTPSAMKSSPQVPHKTYSSILKHLN

BLAST