GenomeNet

>oaa:100087250 K06855 mitogen-activated protein kinase 4/6 [EC:2.7.11.24] | (RefSeq) MAPK6; mitogen-activated protein kinase 6 (A)
MDRLTAEEALSHPYMSIYSFPTDEPISSHPFHIEDEVDDILLMDETHSHIYNWERYHESE
FSEHDWPLHNNYDIDEVQRDPRALSDVTDEEEVQVDPRKYLDGDREKYLEDPAFDTHYST
EPCWPYPDHHENKYCDLECSHTCNYKMRSSSYLDNLVWRESEVNHYYEPKLIIDLSNWKE
QSKEKSDKKGKSKCERNGLVKAQIALEEASQQLVEKEREKNQGFDFDSFIAGTIQLSLQH
ESTDVDKLNDLNSSVSQLEPKGLLSKSVSREKQEKGMANLAQLEALYQSSWDSQFGSGGA
ECFLIDQFCCEVRKDEHIEKENTYTSYLDKFLRQKEDAEMLEMEPADDGKLGEKESEEGF
PDNSGEFLFNKQLESIGIPQFHSPVGSPLKSIQATLTPSAMKSSPQVPHKTYSSILKHLN

BLAST