GenomeNet

>oaa:100092429 TK1; thymidine kinase 1, soluble; K00857 thymidine kinase [EC:2.7.1.21] (A)
MSLNHLLSVHPGRPSTRRILLLQLLRTHSQSDLLGWVILGPMFSGKSTELMRRVRRFQIA
QYKCLVIKYAKDVRYGHSFSTHDRNTMEALPACVLRDVTQDALGVAVIGIDEGQFFPDTV
EFSEAMANAGKTVIVAALDGTFQRKAFGTILNLVPLAESVVKLTAVCMECFRDASYTKRL
GAEKEVEVIGGADKYHAVCRVCYFKKHLGQAPAPVNKENCPLPGPSADAPSPRKLFPPHQ
ILQCSFN

BLAST