GenomeNet

>oat:OAN307_c00690 K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] | (GenBank) ribulose bisphosphate carboxylase-like protein (A)
MTRLTATYEIESPVGVQRAAEVMAGEQSTGTFVRLASETDALRDRSAARLDHVDITGTSE
HPALPCRLSAETYEQGRVTISWPMDNFGPSLPNILATVAGNLFELAELSAIRLVDLGIPD
ALAKGCPGPQFGITGTRKLMGVPSGPMIGTIIKPSVGLSAEQTAALAGDLAQAGIDFIKD
DELQGNGPACPFDGRAKLVMDVLNEAAQKAGRKVMYAFNITDEIDVMRRNIDLLESLGAT
CAMVSLNSIGLAGLRAIRDHSPLPIHAHRNGWGLMSRSPHVGIKYLAMQKLWRLAGSDHL
HVNGLGNKFTEGDTVVTNAARAVQAPLNGATPHAALPVFSSGQTAWQVGPSMELLGNDDF
LFCAGGGIMSHPYGPAVGITSLRQAAAAQKAGEKVEDYAKDHPELAAALTTFKSAVNRS

BLAST