GenomeNet

>ola:100049241 K01360 proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94] | (RefSeq) pcsk2; neuroendocrine convertase 2 isoform X1 (A)
MQRGASGTLISLRRTGRQEDRRKPGTMHGSPRHGTAVGVLVLLNALLFATEAAEGVLTEH
LLVQLHEDAQDEAHQLAAQHGFQSARKLPFGDGLFHFYPQDTSKRRSKRSARIKQWLQNN
RRVKNVIEQEGFRRQKRGYRNINDIEVNMSDPLFTKQWYLINTGQADGTPGLDLNVAEAW
QLGYTGKGVTIAIMDDGIDYLHPDLASNYNADASYDFSSNDPFPFPRYTDDWFNSHGTRC
AGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQTIDIYSASWGPT
DDGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISIN
SAINDGRTALYDESCSSTLASTFSNGRKRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAG
VFALALEANPNLTWRDMQHLSVLTSKRNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGGM
VKMAKEWKTVPERFHCVAGSIQEPHKIQSGNKLVLAINTEACEGKDNFVRYLEHVQAVVT
VNATRRGDLNINMTSPMGTKSLLLSRRPRDDDSKVGFDKWPFMTTHTWGEDPRGTWVLEV
GFQGDQPQRGVLKEWTVMLHGTQSAPYIDQIVRDYQSKLAMSKKEELEEELDEAVERSLK
SLLSKNN

BLAST