GenomeNet

>ola:100049464 etgase, F13a1; embryonic transglutaminase; K03917 coagulation factor XIII A1 polypeptide [EC:2.3.2.13] (A)
MSDTSATPTSPPAPTPTPSKGNRRGRKAGPADNSNSEFANFPEVEYFIAPGPRGYPPLTE
FLDIWDVDMIRRIDESNKLEHHTELYNSENLIVRRGQEFQIKLTFNRPYKPDEDKFAVEF
TIGSSPQFSKGTYIPVFFTKERQSSWAGRAIANSDNIVTVGITPATNCIVGKYNLYVAVV
TPYGVRRQRPDKSREMYILFNPWAKDDAVFLDDEMERQECVMNEMGIIYHGAYNDVAERS
WNYGQFNYGVLDACLFILDHSEMPIINRGDPVKVTRQASAMMNSQDDNGVLVGDWSGDYI
YGVSPTSWTGSTDILISYARSKAPVRYAQCWVYAGVFNTFLRCLGIPSRVVTNFFSAHDN
DGNLKTDIILDENGKIDKNRTRDSVWNYHCWNECYMSRPDLPQGYGGWQIVDATPQETSD
GMYRCGPASVHAIKHGEICFPYDAAFVFAEVNSDVVFYSRRRDGTLDLVKVNRTHIGRMV
LTKAPGEETRRDITSQYKFPEGSAEERTVLEKAEEYGCKRVKDNPSLADVDLTLPTLEIS
VGDDFELDLEFVNHTKEKRTVAAYISGSVVYYTGVPAMSPVQTPHCSNWPQKSVKELVQI
ESKKYMQHLVEQCNLNFIVTGKIKETGKIVTATKLVTLHNPKLTVEVSGNAKVNEEMMVT
VEFTNPFSFSLEDVNVRMEGPGVMLPRRKTFSLILGGSHLTWTELFSPQRPGKTRIIATL
DCPSLRQVDGQVSLTVEP

BLAST