GenomeNet

>ola:101159547 K06067 histone deacetylase 1/2 [EC:3.5.1.98] | (RefSeq) histone deacetylase 1 isoform X1 (A)
MALTSQGTKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
SGEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSVA
GAVKLNKQQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEA
IFKPIMAKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTIKGHAKCVEYIKSFNLPLLMLG
GGGYTIRNVARCWTYETAVALDSSIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNDYL
EKIKQRLFENLRMLPHAPGVQMQPIPEDAVQEDSGDEDEEDPNKRISIRAHDKRIACEEE
FSDSEDEGEGGRRNIAGFKKAKRVKTEGEKEGEEKEKKEVKEEEKVPEEEKMETSK

BLAST