GenomeNet

>ola:101163764 setd2; SET domain containing 2; K11423 histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43] (A)
MDIVAKSEIREEGSGASVKVEGLSKSALIKSLSPRVILSNHLLPKGTKMRVNLEDQGRQK
VSFSFAQTKKPLQSPLFIPASNDTPVTEPQGALSQSSSDRAGKSTDGKAEQKQTLLVATS
VTEIPSPTSVSSSTRLKTNVAKMHFKKQILNVSTVEKPASVSSEELHTSESQKLTSKSEG
GFPMPQPQKSGSLSENAQTELLGTKESPISRKPAASQAKDSDSSSSTDRDNVYKRVTRSQ
LDSAPHASETDGESAHVSSRRQSADSKSKTNSDSRDKVKKSSSSSHVGEREKSSSKRSEN
HERSSSYSKSDRDSRNTSSRSSRLEKDRRRSRSRSGSRSRGARTSSSYARSERYRSDRGS
RSERSYYHESDRRSHRSSPRRERRLSHSRPDRTRESSHSDEDHKRTRTTDSTRSSHHLNS
YKESKSSSSKSDKSSKSVDSSQSSEFDKRSQSSKSERTSKRSDSDSQHKYSPVSDLSYRK
SSSHHKSETNDNTSCSVHTQSKTHEKHHKSSSSDSEGKLHPTDKSTTSSDKCKELEKESK
RPESKETDPYRSPMKSPKHDCQPNGINALSSATISETFPQSEKAQSNLQPERNRHSHQDA
KKIAASTDKVFQESLSREDQEEKSELEIAITARESLNPENITLDNLYTVKECFSSNDQPH
PDHDAAGLHLCKSGESIICKQGENVSDLHPKSSSDEPATQNVIQNTKLEIDKPNEVLALE
NQASKSETLEPDPSCLTNEGQQVKAQSNVDAAKKSSCSSRKSRWDIVGQDIFESDVLQKA
GYPESSPAVKTTRFFNNICHDSEIQQELATLMTLTKQGQISEQEVSLDTITYKYKDQNEP
SQASTTIYHCDLKPTARQTPTNSEEMMHMMDKQQILSFTTQSWNGEGQESEPKENTEKSK
LSKQAPARQDVLGKQSEGSDSDISEYDSDCDKAIKQLHSVVVVPNNSSLTKDAKHREVSP
RHAENLSALSTACLPAWGNTNEVPNQIHSKQTGQSGLSDSLISSVLCQSQSNMIDSTSHS
EGASFMSTQPFFAVNDGTHGQATASIQTSDIFKKVGLELRQHPIPSQDQQVFLYYQREDP
STADRINDNNRFPVGWDFSQSEQPTSTYQQPDSSHGSLLTNTKVTGAASIGPEPRHAVAS
CTQQPPNMQTIKKLYLQEHYQESSSEIHPDSLTNDHDDYSGDKLSSSQVDSLNTPGSSSF
VQAHEISSNSRGSAVPDPSRDDTFRPHRGRGPPKKRRPEVESDSDNEAEVGPSSKRERQR
ETEVSKETLVKAEAQRPPLSLHDFQDAQKWKEFARSKKMPPYFDLIEENLYLTERKKSKS
HRDIKRMQCECPVLSREERGKGVMACGEDCLNRLLMIECSSRCLNGAYCSNRRFQMKQHA
DFEVILTDDKGWGLRAAKEMAPNTFVLEYCGEVLDHKEFKTRVKEYARNKNIHYYFMSLK
NNEIIDATLKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKAVAAGTELTFDYQFQR
YGKEAQKCFCGAPSCRGFLGGENRVSVRAAGGKMKKDRNRKSALTTVDEELEALLENGEG
LCDEKQVVSLCRLMVRVETMEQKLICLKLIQNTQNPSCLKQFLDHHGLSLLWIFMVELSE
AKGNSATGIKMQIEIMKTLAVLPISTKNMLEESKVLTLIQRWAQTKTLPQQTEMDGYSSE
NTSRAQTPLNTPDGSSSKLGPELDSEASKPAVYRRLKIISENSLDSALSDASKASDGKEE
EEDEEDEEEDEPMQGDPTEGKELKVEAADATKESTLESVADNDSGKQEELEMSGTSEQQP
QSLTVETKSDSDVKMEDFEMKEDTAEDQRDPQQEVPSDEQDGSEKQINLTLAEKPDLEVD
QPNVSESQSSQEGADDLPAEQPSETLEVCEELQEADKPPPPPPPPPPPPPSQTDPHPGES
TTDVSPSSETTEATVPPEVTATAVEASAVGTPSQDEEEGLSDVESERSQEPQHNVLDISS
MAARLLETWKDLKEVYRIPKKSQVEKEARNRSRDRDTGLKPRTTSGSRERERERERERER
ERERDRDRDRDYEKDRDRDWDRDRERDRDRISDKTPRSSERRRRRSLSPPPSSYERSSRR
TEERFDLSNSKTPRVVSSKERNKLSTEERRKLFEQEVAQREAQKQQQQQQQQLQQQQQQL
QTMVYDPALAYVSSPSFITYPPGYPIQTFVDPSNPNAGKVLLPTPPVDYEQTPPLASAGL
VSEIGIPSPSSSSQTTPVSNLTQHITTTNIATGTPQQYAQPNVATQDTGVAVLSVPPQPA
TQVQSQQSYTTLWDPTTQQAVTVQTQPAQQYAAAAGQAQPQAAIYYQGQPCQAIYSIPAA
YPQANPPVIQAYTEPTASYLHGQAVYPSHQQGVVVQQGGTVTTIVTSQTVQPEMIVPSNV
IDLPPPSPPKPKTIVLPPNWKVARDPEGKIYYYHIVTRQTQWDPPTWEGSSDSTSVDHES
EMDLGTPTYDENPSKFSTKTAEADTSSELAKKSKETFRKEMSQFIVQCLNPYRKPDCKSG
RISNTEDFKHLARKLTHGVMNKELKACKNPEDLECNENVKHKTKEYIKKYMQRFGTVYRP
KEDTDVY

BLAST