GenomeNet

>ola:101165180 protein-glutamine gamma-glutamyltransferase K-like; K05619 transglutaminase 1 [EC:2.3.2.13] (A)
MPGERLTVRGASEVGRFPGAAPPTRVEVSIQRQEKKREDGGCRRWFRKICPCCCKRQNSS
SYDVTDKVELKVPSPTPPPVISPEPTKPKPENGEAKEMEEIKLKVCSVDLLSSRTGQNRK
EHHTDLYHGDELIIRRGQTFQMEMELNRPYDPDTDKILLELKTGPLPLVSKGTHIIIPLV
DHLEDGRWEAKITDQSDNKIKLSVNSPANAVVGLYGFTVTSRHVKNETANTHNPDKNIVI
LFNPWCEEDTVFLDDEEQRKEYVLNDTGRIYYGTEKQIGARTWNFGQFHEGILEACFFIL
EKSDMPPSGRRDPINVVRVISAMINIQDDFGVLVGNWSGNYSDGVSPNAWTSSIEILRKY
HSTGGEPVKYGQCWVFSAVTTTVLRCLGIPTRSVTNFQSAHDTDVSLTTDVYYDENMEPI
DELNSDSVWNFHVWNDCWMARPDLPPGYGGWQAVDSTPQETSQGTFRCGPASLIAIRSGH
VYLKHDVPFVFAEVNSDKIHWQRNLDGTFSQVHIEKKAVGHCISTKAVGSDDREDITYLY
KHPEGSEEERIAVETASRYGSKPEVYSAPIAEDVCVEVKMDGEGPRIGSDAQLSIVVKNM
SSQPRRATLHSQAAIMYYTGVLKNAIKKDQILVELLPNEGANCSRLRRPLLSIEWVLPYQ
QYQDQLVDQAALMMTLSGRVTETKQVLANQMTFRLRTPDLKLTPLGEAVVGKEMSAKITF
TNPLPRTLKGVLFRVEGLGLQKGHEVVVGDVGGHSTVTLTEHFIPTQPGTRKLVASLDCK
QLSQVHGVADINDLLIQKNLVIKDFCTLRRDVPWSLCITVVDVLCHGVVIEQIFKLPPEI
GAESVHQTRA

BLAST