GenomeNet

>ola:101171223 K01229 lactase-phlorizin hydrolase [EC:3.2.1.108 3.2.1.62] | (RefSeq) lactase-phlorizin hydrolase-like isoform X1 (A)
MKELLWVACLYIFCLHGCGSLGVNVKEDFMLLAGPLIENVATSPDKEGLDVSECSLPIVA
ASEPYLKGLQSRGVTHVKVPLSWAQLLPTGLASQPQQDALQCYKTLMKQLLKVGLQPLVI
LHGSTVPDTLRARYGSWVSQELVDMFQQYAEFAFREFADLAHSWVTLSDLGSIWQNGPTA
QQNILQLNKNVYKIFHEHIPSKLSGRRGLSFGLDAANVAILSQIEASTTADFLSVHIEYS
CASSADFEQSLRNMQISSRNLPILISKMNVRDCTDSQHEPLRELLHVLQSSGLNIIGCDI
VDVLLRMDVQDASFGYHHQDSIGIPESRNAYQSVWDKFGSQTAAERDVFLDESFSSGFQW
ATSAESFKVEGGWLEGGKGETIWDRFGHDNLAFENQTADLACDSYNKVEYDVYLLRGLQV
NTYQFSISWARIFPSGHRDSQTEKGVLYYDKLINTLIESGIQPVVTLYHWDLPQALQDNG
GWTNPTIVDAFKDYADFCFSRFGDRVKTWNTFSSPWVVSHAGHGTGEHPPGVKDYASSSY
QVTHNIIKSHAEAWHVYNDNYRATQGGIVGIALNSDWAEPKTPTNSEDIAAADRYLQFML
GWFAHPIFVDGDYSVALKTQIELKLKECPSSPPAVLPVFTSEEKARIKGTADFFGLNHFT
SRLVNTVKGGCTSGPEGVGDYAAGVDPSWPSTASDWIYSAPWGLRRLLNYISLEYLSATK
VPIYITGNGMPTANSSETINDVSRVEYLRRYINEALKAQAIDGVDVQRFTVQSLMDGFEG
PQGYSERFGLLYVNFEDANRQRTPKQSAYFFSGVVENNGFGTARHDFKKVTELKFTPRSS
KLLASEVPSEAKVVWDTLSRQTKFQRHVYHYGTFPQDFIWGVSSSAYQIEGGWNADGKGP
SIWDKFTQAPGNIPENANGDVACDSYNRIDEDLFMLKALKVKSYRFSLSWSRIFPDGRRS
SLNQKGVDYYNRLIDSLLTQGITPMVTLYYWDLPQALQDIGGWESVQMIDLFNDYCDFCF
ATFGDRVKFWITFNQPHTIAWAGYGTGAMPPNVNSPGSAPYEVAHNLIKAHATAYHTYDD
KYRASQGGLVSIALDADWVEPYDVNVHREILAADRAMQFRLGWFAHPIFKNGDYPEAMKE
QVRVKSELQRLTESRLPSFTEDEKNFIRGTADVFCINHYTTKIVNHVTDQLTPPSYQFDR
DIVENEETNSPTTVIGGQRAVAWGLRRLLNWIKEEYGDPDIYVSENGAATDRGMTWDDID
RVFFYKTYIDEVLKAYELDGVKVKGYIATSLLDSFEWLHGYIYAFGLHYVDFNDPNRPRT
PKFSAHYYYQVMKNNGFPETAEFGKLWGHFADGFMWSTATASYQIEGAWRADGKGISIWD
KFTHTPGKVLNNDNGDIACDSYNKLEVDIGLLKQLKVTHYRMSISWPRVLPDGTINNINE
AGVDYYHRVIDALLAANIQPQVTLYHWDLPQAIEDQGGWLSDIVVDRFRDYADFLFSRFG
QKVKFWITINEPYIIALLGYGYGSFAPGISHDPGSLHYVAGHNVIKAHAEAWHVYNDKYR
AEQKGRISITLNSDWAEPRNPYKQEDIDAAKRYMDFFLGWFANPIFNGDYNEPMKRIIRE
RSLAAGLEKSRLPEFTPAEIERIKGTHDFFGLNHYTSVLAFSVDFGDTQNYDADRGVVVI
SDRTWLESGSNWLRIAPLGFRKLLKYIKDEYGDPPILVTENGVSENGPVDLNDEHRSFFY
ENYINEALKANMTDGANVIGYTAWSLMDNLEWASGYGERFGLFYVNHTNADRPRTPKASV
PFYTTIVRCNGFPDPADGPHDCTNSLSSTSAPISEAVTKEPIQENPVNFLGMKLSIDEAV
TGLNTTFALLIVSVVAVAGVTALLIVSRKRSKKRKNDP

BLAST