GenomeNet

>ola:101172772 K01283 peptidyl-dipeptidase A [EC:3.4.15.1] | (RefSeq) ace; angiotensin I converting enzyme (A)
MAVGPVRLLWSVLLLLPVLGLSEALPADWLPGEYVNTISDAQRFLSDYNSTAEEVFYFSV
SASWNYNTNLTDHNSKLQVAASLEEQAFIEAWGLKAKTVFTDEVLNTLPDPKDKKLMEKI
KSLGAANLPQAEREKYNTILSTMDSIYSTAKVYPQPNVSWSLEPELTDIMATSRSYKKLL
FAWDGWHNASGVPLKKLYPEFVELSNKASQADGFADTGADWRSWYESETFEQDIDNLYKT
IEPLYLHLHAFVRRKLYNQYGSKYINLKGPIPAHLLGNMWAQTWNNIYDLMIPFPNKPNL
DVTDEMVRQGYNATHMFRVSEEFFTSLGLLEMPTEFWEGSMIVKPDDREVVCHASAWDFY
NRKDFRIKQCTTVTMEQLFTVHHEMGHIQYYLQYKDQPVGFRRGANPGFHEAIGDVLSLS
VSTPKHLHTINLLESAASDTETDINYLLKMALEKIAFLPFGYLIDLWRWGVFNGRTPPEK
YNSEWWYLRTKFQGICPPTKRSEEHFDPGAKYHIPGNTPYIRYFVSFILQFQFHEKLCEA
AKHTGPLHTCDIYRSAEAGEILRKVLQAGSSKPWPEVLQEAIGTREMNANSLLKYFEPVI
KWLEEQNVNETLGWPDFGWVPPVPEGYPEDIEKNTDELDAKRLLDEYNTTAEEVWNAYTE
ASWKYNTDITDANKQAMLNRSLEMSAHTLKYGLKAREYDTTDFQDPLVKRVIAKLSDIER
AALPPEELEEYNTLLSNMETKYSVAEVCREDGRCHPLDPDLQKIMAESRDYNELLFAWKG
WRDAAGKVLRQDYERYVELANKAAVLDGYSDNGAMWRSLYETPTFEEDLESLWMELQPLY
QNVHAYVRRALYKKYGPQHINLKGPIPAHLLGNMWAQTWSGIMDFAIPYPGATQVDATPA
MLAQGWNATRMFQESDRFFTSLGLLPMPEEFWEKSMLEKPSDGRQVVCHASAWDFYNRKD
FRIKQCTVVTMDDLITVHHEMGHVQYFLQYKDQPVSFRDGANPGFHEAIGDVLALSVSTP
KHLKSIGLLDKVEENYESDINFLMSMALDKIAFLPFGYLMDQWRWKVFDGRIPPNEYNKE
WWNLRLKYQGLCPPVARTEEDFDPGAKFHIPANVPYVRYFVSFIIQFQFHKALCEAANHN
GPLHTCDIYQSKEAGKLLSDVMKLGSSKPWPEAMAIITGQSKMSAQPLMQYFEPLIQWLQ
RENQMNGDVIGWPEYDWIPQEKFEVANKVEFLGLYLYESSASTGSWVLLGVALIFAVTTI
VFVYKYKKAKKYRKSSSTLELK

BLAST