GenomeNet

>ola:101173634 K00509 prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1] | (RefSeq) prostaglandin G/H synthase 1-like isoform X1 (A)
MKAVRLLFICVFMILMKKSSSTKVNPCCYYPCQNTGVCVRFGLEDYRCDCTRTGFYGDNC
TTPELWTRIRLALKPRPSTVHFLLTHFQWFWELINSSSLRDTIMKMVLTVRSDLIPSPPT
YNTKYGYLSWEAYHNTSYYTRLLPPVPADCPLPMGTKGKPVLPDVKLLTERFFRRQKFRP
DPQGTNLMFAFMAQHFTHQFFKTNRKAEGGFTNALGHGVDASNIYGEELARQHELRLHKD
GKLKYQLLNGEMYPPTVSEVPVHMVYPDSLPPEQRLAIGQEVFGLLPGLTMYATIWLREH
NRICDILKAEHPTWDDEQLFQTTRLIIIVSLSGQIINIITEEYVQQLSGYHLKLKFEPSL
LFNVRFQYSNRIALEFCHLYHWHPLMPDSFVIDGDEIPLTSFIYNTSILMHYGVEKLVDA
FSRQAAGQIGGGRNSHEAVLKVAQMVITESRRTRMQPFNEYRKRFNLKPYASFQEFTDDK
EMAEGLEELYGDVDALEFYPGVLLEKARANSIFGESMVEMGAPFSLKGLMGNPICSPEYW
KPSTFGGETGFNIVKTSTLKKLVCLNTKWCPYVAFRVPPNQEEAGGRKASTEL

BLAST