GenomeNet

>olu:OSTLU_13873 K00128 aldehyde dehydrogenase (NAD+) [EC:1.2.1.3] | (RefSeq) hypothetical protein (A)
MRACFAAGLSLPLQKRRQQLMALLKMIREHEAEMLAALREDLSRVGVEALYYDVILPRSE
IKAMVNNLRAWTGRRRVWTQRLITWPSSQWTEKQPRGCALVCSSWNFPFMLSLVPLAGAI
AAGNTVVLKPSNESAVSTALLVKLLRQYCDPRVVQCVGSEVKGDGIDVMQTVLKEKFDMI
FFTGSTTVGKIVARAAAENLTPTVLELGGKNPVVVTDCADLNIAAKQCMWGRTINCGQQC
IAPEYVICHESRADRFMELCKTWANRFVPDASVDGAMARIGGPNPASRMAKIGKMLDDAK
SGVEGDQIICGGGYDVTRRMVEPTVVKCASEKSPFMNAELFAPILCVLPYKTLGQAVDLI
RSKPKPLSMYVFSRTASKTRILIDNTHAGGVTVNGTLTHCAHDGLPFGGVGESGFGRYHG
RYSVDCFQREKPVLQKTRGLGFLGFGLITDPPLVYSPPAEWKTRVARMVLG

BLAST