GenomeNet

>olu:OSTLU_14315 hypothetical protein; K00857 thymidine kinase [EC:2.7.1.21] (A)
MFAGKTTHLMRCVERERARGRTVFVIKSELDVERFGEDARDALIAHDGKRVRFDASDDGG
RVRAVRTLDAAGLGADAAACDAADVVAVDEAQFMGDLAPFARRCAEELGQTVYVCGLDGD
YRRERFGGVLDLIPLCDTVTRLRGTCAECGDESLFSRRVEASEDVVRVGGRDKYAPVCRA
CYVAASTRERGSASAR

BLAST