GenomeNet

>olu:OSTLU_14315 K00857 thymidine kinase [EC:2.7.1.21] | (RefSeq) hypothetical protein (A)
MFAGKTTHLMRCVERERARGRTVFVIKSELDVERFGEDARDALIAHDGKRVRFDASDDGG
RVRAVRTLDAAGLGADAAACDAADVVAVDEAQFMGDLAPFARRCAEELGQTVYVCGLDGD
YRRERFGGVLDLIPLCDTVTRLRGTCAECGDESLFSRRVEASEDVVRVGGRDKYAPVCRA
CYVAASTRERGSASAR

BLAST