GenomeNet

>olu:OSTLU_18587 K11423 histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43] | (RefSeq) SDG3502; hypothetical protein (A)
MAPSDALTRLLEETPLTTDAWVQCDSCETWRRVPRVVADRLGENTAWFCHQNLDQKFSTC
DDAQELSDDEIDRLMRAQAHAATSAANGEDACDGDSNARARGRAVTNEWYRTTRNIFAHR
APRTPSEDDAMICACAPESGAGCGSDCLNRLVLSECDPAHCPCGSACGNQRMSRGESRAT
TVRRTGKKGHGLFAAERVGAGEFVLEYCGEVLHEEAYKERKRRYQDEGRSHYYFMTLSSS
ETIDATIRGNEGRFLNHSCAPNCETQKWMVRGELCIGIFATRDIEEGEELTIDYKFERFG
EKPSRCYCMAGACCGWIGGAKAAEAAKAYNVDGDDDEGHEDDPEPIMRELDEALIAQEEA
KGREQMADKYAPKKVAVKAENKSWRPPEEVREIERQRKATERDENRAARAARSSGGSNVR
RVKIPAGSYAQKWSAMSAGAKKRTEVDLTMEELQSTTGGLRSKDAVSHCVQLFNLCYPVD
ADGVTQINTRDLGLILEAISLTKNPSLQQELVGGGVMSCFQKCINVLGGPTASAAHAALQ
RKILKILMDLMLHFKEFVITRIGETRTAAGTLMQAIGDLRVANDTPLMKLARDFEYKYIG
TGVMGPMPERPRAQPPQQQLRRNDSGSGSGAGWGMRSPSTGSLNRYGSSPAGSMFNGSAP
PRSAMSGGRGGFNGSAPPRSAMSSGGIRGGGYGGGYGAPPQQQSSLSQAMRPQSQAYPPQ
QRDGGWGPPPAAAPPHSSYDDGRGIKRARDEPLRQPQRPRATASKPLLTQPLPAQFEDPR
SELFADAVTAFVTMEVEDLRAPSHPLHDPRANYDRLTQRWALEALENEHAQWNQSDARPL
PVSQVRERVVSHVRSAARAS

BLAST