GenomeNet

>olu:OSTLU_29304 hypothetical protein; K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] (A)
MRACERGCVAARNALTTSASGSGSGSGSGRSIATAASSSTSSYEIIDHEYDALVVGAGGA
GLRAAIGLGEHGFKTACVTKLFPTRSHTVAAQGGINAALGNMTEDDWRWHAYDTVKGADW
LGDQDAIQYMCREAPKAVIELEKYGMPFSRTDEGKIYQRAFGGQSLDYGKGGQAYRCAAA
ADRTGHAMLHTLYGAALKHDVQFFVEYFALDLIMDKGECVGIMALCLEDGTLHRFRSHQT
ILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDQEFVQFHPTGIYGAGCLITEGSR
GEGGILRNSEGERFMERYAPSAKDLASRDVVSRSMTLEIREGRGVGKEKDHIYLHLNHLP
PELLAERLPGISETAAIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKGEVVAPKNGDPDAI
VPGLLAAGEAACASVHGANRLGANSLLDIVVFGRACANTVADKLKRGAPHREIASDAGSN
AIERLDKIRNSKGSAPTAMLRKTMQKVMQEDAAVFRTQETLANGCKRIDDVAAQLDNLKL
TDRSLVWNTDLVEALELHNLMPNAQTTMHSAEQRKESRGAHAREDFPDRLDDVWMKHTLA
YVENGKVKIDYRPNHHYTLDAEMDVIPPKARVY

BLAST