GenomeNet

>olu:OSTLU_32608 rbcL; hypothetical protein; K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MAPKSFEDMFACSPASLTKLRASHAPHASPAASHARDYSPIAFPSMRRDDEDERARAVAG
AFDDMFACSPASLKKMRGSAVERASGGVGTPTGTPTRPTASREDLASAFGDMFLASPASL
KKMRATNTAVTGTKARERGDGFGSPLRYDGDANAAEPKKEAVSFSEMFASSPSDLAKMRR
SDVGGAARGSNVEVAKVAVDARERTNAFAGMFASSPADLAKMRGRSQSSISYAEGRHGAS
DRFQVIAPDFQAMFSSSPSDLKNLRSASSSSRKRLGDEADRFEVTYLLLAPCEAAAREKV
LEICLEQTVELPASLVPEGTWIREHVVGRLESLTKPKTGPHARRPDAWNAIVSYHADTAG
GELTQLVNVIFGNTSMKENVMVVDIELPRTMLREYPGPRFGVHGLRRLLRVPEGPLVMTA
LKPMGLSSQELAEIAYGFAKGGIDIIKDDHGLADQPYSPYDERVRMCAAAVARANAETGR
NVLYAPCINAPAHLIISRAHAARQAGAGAVLMIPGITGLDAMRELAADPSFNLPIIAHPA
LLGCMLGGGSTNRIAGFSHEVLLGLLPRLAGADATVFPSFGGRFGFSVDECKAINVGCTR
VMGDLPAILPSPGGGMTLERIAQMREVYGPDLLLLIGGSLYSHSENLVDGARHFMKLAGR
KELYGPLECPHDGYRGHTM

BLAST