GenomeNet

>olu:OSTLU_37009 hypothetical protein; K00850 6-phosphofructokinase 1 [EC:2.7.1.11] (A)
MYGLEKRPSPFAEGGSLWEFGLGQRFIDNRDSVSLNPLRTSYVGGEDTAFSDERAVRAGA
REEIYYDPKRVKAAIVTCGGLCPGLNDVIRSITTTLEDYGCEEILGIKYGFRGFFGDEAA
DANPLEAPMKLTSEMVEDIQITGGSMLGSSRGGADMPAIVQKIEDMGIDFLFVIGGNGSH
AGALAIDKLCREKGLTTSVIGVPKTIDNDILLLDRTFGFQTAVDEAVKAIRSANIEARSA
DNGVGLVRLMGRQSGFIAMHAALASGNTDVCLIPEIDCPLEGDGGVLAHIKRVVERQNHA
VVVVAEGAGQEQLGMIGETDASGNPILQNFAKYLQQKLKDAKPECDIKYIDPTYMVRACR
TNASDAVYCSILGQNAVHAAFAGLSAVTVGMCSGHYVYLPIPPVISAARTVDPEGRMFER
LRFAIGQPTFSKT

BLAST