GenomeNet

>oni:Osc7112_4189 K01921 D-alanine-D-alanine ligase [EC:6.3.2.4] | (GenBank) hypothetical protein (A)
MIPTSISLNRWHYDFSLLPQYFEVLFAKLRIAVVFGGDCNRPGSVIYKTHNPRSWKSYEA
VAREIARALAEIGFQQVFVMPDDMNLPEQLKQKNIHLVWLNTGGVQGYNPVCHTPAQLEM
LGMPYVGHNPLNSSTLDNKHAFKRELQSVGIQTAPFMTWHPSQGILQPNLHQRFAIAFGD
YQGPFVVKPVSGRASLHVHFVDKLEGLSEAVSEVHRATHNTALIEKYLPGREFCVAVCGY
VKYAKGGFSKNIKPLAFSTVERVLEPDERIFTSMDKKAITADRGRLMGGEEPELKQELIE
LARKIYWEFSLNSLVRIDVRSDADGSLYVLEANPKPDLKHPGENVTSLVALGLAEYGMSY
NDLIFSLLADRLDYLLTQHIEIIPHIVDLLH

BLAST