GenomeNet

>opr:Ocepr_0487 DNA polymerase ligd, polymerase domain protein; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MARREVWGLAGRRVEVKNLDKVFWPEHGYTKGDLLRYYREVAPVMLPYLRGRPLTLVMCP
DGIAAGCYYRRKRPDYAPDWMPYVPYNPRTKTGQVPLILVEDEAQLIWLANQAAVEFHVW
ASPARDLAHPSWLVLDLDPGNATGFGAVLEAARFVRKELEELGLVGWPKTSGGRGLHLLV
PLEPGRYSHAEVRAWAKAFAARLAERSGGLLRLPHGATHRGSGVFVDYAQNGYGRNTAAP
YSLRARPGAPVSTPLGWDEVEAGGFQPADFNLETVPERLRRSGDLLHGLQEHRQRLADL

BLAST