GenomeNet

>osa:4331376 K00857 thymidine kinase [EC:2.7.1.21] | (RefSeq) thymidine kinase isoform X1 (A)
MSSICAMRSLLAASTFLRSGASPLLRPLSRPLPSRLNLSRFGPVRPVSAAAAAADKSRGG
GGSAMEAQPSYPGEIHVIVGPMFAGKTTALLRRVQVEAGTGSRNVALIKSDKDNRYGLDS
VVTHDGTKMPCWALPELSSFQDKLGTEAYDKVDVIGIDEAQFFDDLHDFCCKAADRDGKI
VVVAGLDGDYKRNKFGSVLDIIPLADSVTKLTARCELCGRRAFFTLRKTRETKTELIGGA
DVYMPVCRQHYLDGQIVIEATRIVLDLEKSKVIHAFK

BLAST