GenomeNet

>osa:4331376 TK; thymidine kinase; K00857 thymidine kinase [EC:2.7.1.21] (A)
MSSICAMRSLLAASTFLRSGASPLLRPLSRPLPSRLNLSRFGPVRPVSAAAAAADKSRGG
GGSAMEAQPSYPGEIHVIVGPMFAGKTTALLRRVQVEAGTGSRNVALIKSDKDNRYGLDS
VVTHDGTKMPCWALPELSSFQDKLGTEAYDKVDVIGIDEAQFFDDLHDFCCKAADRDGKI
VVVAGLDGDYKRNKFGSVLDIIPLADSVTKLTARCELCGRRAFFTLRKTRETKTELIGGA
DVYMPVCRQHYLDGQIVIEATRIVLDLEKSKVIHAFK

BLAST