GenomeNet

>osa:4347138 K00814 alanine transaminase [EC:2.6.1.2] | (RefSeq) alanine aminotransferase 2 isoform X1 (A)
MSYNHSPSITAETINQKVRIFTYEPCGEIVRHARRLEKEIYENPGSLPFQEIIYCNLGNP
QALGQRPINFFREVLSLCDNPSLIDRDEARALFRLDQIDKHPCALKRARKIIESLPGRDS
GSYTSSQGVRGLREAVADGIAARDGFPSKPDNIFLTDGASSAINMMMQILIRSHEDGILC
PLPEYPLYSASIILHGGTMVPYNLTEDSIWGLEIFEVKRCLEDARASGLTIRAMVVINPG
NPTGQVLSITNQEEIVEFCRKEGLVILADEVYQENVYTENKRFNSFKKVARSLGYDHHDL
SIVSFHSVSMGYYGECGRRGGYMEICGFGDDVIDEMYKLASLTICPNIAGQILISLVMDP
PKLGDEAFEIFMVEKEETYSSLLKRAKALQKAFNGLEGVSCNKFEGAMYLFPRLRLPQAA
IKAAQLEGVSPDVFYAHRLLDATGIAVVPGSGFHPVSGTSHIRCTILPGEETITAMVPSL
QAFHEAFMDEFRG

BLAST