GenomeNet

>osa:4347903 K01177 beta-amylase [EC:3.2.1.2] | (RefSeq) beta-amylase 2, chloroplastic isoform X1 (A)
MISSPALFFLLQPGRPSIAAPPLPSSPAPPLRGISISPVAARPISSLRSSSSIRIISPPH
ALPDPLLSLPSMDPQEVPDLLPPRPPERDFAGTPYVPVYVMLPLGVVNGNGEVVDADVLV
GQLRVLKAAGVDGVMVDCWWGNVEAHRPQEYNWTGYKRLFHMIRELKLKLQVVMSFHECG
GNVGDDVSIPLPHWVTEIGRSNPDIYFTDRAGRRNTECLSWGIDKERVLQGRTGVEVYFD
YMRSFRVEFDEYFEDGIISEIEIGLGACGELRYPSYPAKHGWKYPGIGEFQCYDRYLQKS
LRRAAEARGHTIWARAPDSAGHYNSEPNLTGFFSDGGDYDSYYGRFFLNWYSQVLVDHAD
RVLMLARLAFEGSDIAVKVSGVHWWYKTASHAAELTAGFYNPCNRDGYASIAAVLKKHGA
ALNFTCVELRTMDQHEVFPEAFADPEGLVWQVLNAAWDAGIPVASENALPCYDRDGFNKI
LENAKPLNDPDGRHLLGFTYLRLTKVLFERANFLEFERFVKRMHGEAVLDLQV

BLAST