GenomeNet

>ota:Ot09g01820 Farsla protein (ISS); K01889 phenylalanyl-tRNA synthetase alpha chain [EC:6.1.1.20] (A)
MDDVERDVLAAIAASGTVNTGTIAARLGVDREVTVGVMKRLLAADMIASTPIDRSMLTLT
DEGARAIEIGSPEARAHAAVPSEGMEDVADVGFKQAMQCKWLTMVKGERPRIERAVETIV
DETRETLRKVQRGEMIEQKTTEALKKRKLIKEEKWKEYELTKGAEFALERKVLPADLTKE
MMNEGSWKGQEFKAYNLVPGAGAQPASGHVHPLLKVRQAFREIFFSLGFSEMPTNNFVES
GFWNFDTLIQPQQHPARDAHDTFFMKX

BLAST