GenomeNet

>ota:Ot14g00120 succinate dehydrogenase flavoprotein alpha subunit (ISS); K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] (A)
MFASTSRRALRRGCVGPVAALATGASAASTAAVSTASMASASSMASASARASVDARGGRS
WTNGARGGGRSRRSRDGFARAYSGTSASSAYEIIDHEYDALVVGAGGAGLRAAIGLGEHG
FKTACVTKLFPTRSHTVAAQGGINAALGNMTEDDWRWHAYDTVKGADWLGDQDAIQYMCR
EAPKAVIELEKYGMPFSRTDDGRIYQRAFGGQSLDFGKGGQAYRCAAAADRTGHAMLHTL
YGAALKHDVQFFVEYFALDLIMDKGECVGVMALCLEDGTLHRFRSHQTILATGGYGRAYF
SATSAHTCTGDGNAMVARAGLPLQDQEFVQFHPTGIYGAGCLITEGSRGEGGILRNSEGE
RFMERYAPSAKDLASRDVVSRAMTMEIREGRGVGKEKDHIYLHLNHLPPELLAERLPGIS
ETAAIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKGEVVAPKNGDMDAIVPGLMAAGEAAC
ASVHGANRLGANSLLDIVVFGRACANTVSEKLKPGTPHRQIAADAGSNAVERLDKIRNSK
GSAPTAMLRRTMQKVMQDDAAVFRTQESLANGCKRIDDVAAQLDNLKLTDRSLVWNTDLV
EALELHNLMPNAQTTMHSAEQRKESRGAHAREDFPDRLDDTWMKHTLAYVENGKVKIDYR
PNHHYTLDDEMEVIPPKARVY

BLAST