GenomeNet

>ota:Ot16g00420 K00799 glutathione S-transferase [EC:2.5.1.18] | (RefSeq) Intracellular Cl-channel CLIC, contains GST domain (ISS) (A)
MGLTPERRTGGGVRATGTTFTTSATCPFAHRCWLALTELDAGYDLELVNLEAKTEAFETL
FARAAPDARANPSVPILTHDGTIMVESALILKYISETFEREGKSIRASGKTGYYGQLFAD
TFQQCVPVFFKMLRATNEADLGEAVDAFVAGLKKANRVLELGAAARAGGPYACGEQFTTC
DIMAMTFVPRFEIVLAHYRDFNLRETLARNECSALEKWIDAVSSRPSLVYTFGEIERLTG
KTHEQAFVDHFAKFVTWRSNEGRVAT

BLAST