GenomeNet

>ota:Ot18g02030 rbcS2; Ribulose-1,5-bisphosphate carboxyase/oxygenase small subunit (IC); K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] (A)
MSAVAQVQQVAKTVAVSTGKVANAKSMMIWRPHGNKMFETFSFLPPLSDAEIAKQCQYLL
NNGWTPCIEFEDAEHAYADGHGWSNLDSSINSLYYDNRYWVMWKLPMYGCQNTDEVLAEV
NMAKKCFPDCYIRVVGFDNIKQVQCAGFLVYRPASGAACAVDKRQIQG

BLAST