GenomeNet

>ote:Oter_4190 K00164 2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2] | (GenBank) 2-oxoglutarate dehydrogenase, E1 subunit (A)
MKPLNVSANANTAVIEAAYEAWLKQPDSVDPTWRAFFQGFTLGTSGGSLGTEGANLRIID
SYKQAQVGRFINAHRAHGHLQAHLDPLGEPPPADPKLTLSYFGLDENDLGESFTLTNFKG
GGQMKLRDIVDALRQTYCGHIGVEYMHVQEHAAREWLQVRMEQTNNQPRFSRAEKIRILR
RLHKAELFEKFLHTKYVGQKRFSGEGAETFIAAIDAMLEKCPELGVEEIVMGMAHRGRLN
VLTSIMRKPFEVLFEQFSENYLPESVAGDGDVKYHLGYEAILDTSSGQKVEIRLAANPSH
LEIVDPVVEGKARARQRVRHATSERQRVLPFLIHGDAAFAGQGIVAETLNFSQLPGYTTG
GTVHLVINNQIGFTTLPHEARSTRYCTDVAKMVEAPIFHVNGDDAEAVCLVAQLALEFRV
RFQRDVVIDMVCYRKHGHNEADEPAFTQPVLYRQIAAHPLVSSILTEKLVREGTITPDEA
EAIKAEYTAALEANFERAKAREKEKEGARSVQQSQAIEREKFKGSTAFFQPAYRHSTIDT
GAEPALINRVVAGLTTIPGSFKLNPKIRRFLDNRIRAHREGGPIDWGFGEALAFGTLLLD
GTPIRLSGQDCERGTFSHRHAVLYDVDTREQYVPLKNLDPQQPAFCVYNSLLSEAGVLGF
DYGYSMDYPQMLCIWEAQFGDFVNGAQVVIDQFIASSESKWQRASGIVLLLPHGYEGQGP
EHSSARLERFLGLCAEDNIQVTNITTPANFFHLLRRQMKRDFRKPLVVMSPKSLLRHPAC
VSRLDEFTSGRFQEVLDDPKPPAKVERVIYCSGKVYYDLCDFRDRHHLNDVAIVRIEQLY
PLHRDRLAAVADRYNGARIVWCQEEPQNMGAWTFIAPRLAEIYGFPPKYAGRDAAASPAV
GALALHKFELNALLQDAFNI

BLAST