GenomeNet

>ote:Oter_4308 DNA polymerase LigD polymerase subunit; K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MATKTELVVAGTRLMVSNLDKVMYPKTGFTKGNVIDYYVRVADVLLPHLKNRPITLKRYP
DGVAGFFFYEKQCPPHRPKWVKTATVPRGKREGEIHYCVMNDLPALVWAANLADLELHTF
LHKAPAIGRPTAIAFDLDPGPPADIVLCCQVGLWVKAVFDRLGLKSFAKTSGSKGLQIYV
PLNTPVTYDRTKAFAHTLAQALERQFPDVVVSKMLKSLRTGKVLVDWSQNDDHKTTVNVY
SLRAKDQPTVSTPVTWEEVEAAWKKQKADLLVFESEDVVKRIAKHGDLFAPVLQLKQKLP
PIGELA

BLAST