GenomeNet

>pab:PAB2342 K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] | (GenBank) Hypothetical protein (A)
MIPRIMSTQHPDNYSIPFFANSPVLGGEDEITEAFYAFNVLGADEQMWDFEGKEVDEFVV
KKLLERYPSFFRKVILGKDVRLTPRVPNPTVEKAEAKLLLETLQGITRAADYARVFYGED
IAPIFEVILPMTTSLAEIERVHELYRKVVNLADERIYDTTVKEWIGEFYPKEIGIIPLFE
TKVALLKSAKIIGEYLERREPEYQRVFLARSDPAMNYGLISAVTYVKNALQEIWELEEET
SIPIYPIVGVGGPPFRGGMRPDNVDNVLSEYPSVQTYTVQSSFKFDYPTKEVVKAVEKVK
STKRKEPYSLEVPDFITLYEVEYQRQVKILAPHIRRLATRIPDRRKRKLHIGLFGYSRNV
GGLSLPRAIKFTASLYSIGVPPELLGLNALTDRQLDVVSEYYVNIYEDLEFAMRFFSFRV
AEKAGLKELVERIKEFKPEIEEEYVAEAEIVFRGEGDIIKLAQMRGFLG

BLAST