GenomeNet

>pae:PA1623 K11209 GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-] | (RefSeq) hypothetical protein (A)
MIDLYTAATPNGHKVSIALEEMGLPYRVHALSFDKKEQKAPEFLRINPNGRIPAIVDRDN
DDFAVFESGAILIYLAEKTGQLMPTDVKGRSRVIQWLMFQMGGVGPMQGQANVFFRYFPE
KLQGAIDRYQHETRRLYEVLDGRLGEAEYLAGDYSIADIATYPWVRIHDWSGVAVDGLDN
LQRWIAAIEARPAVQRGLLVPRREKEGDDAIRTAQSMLTR

BLAST