GenomeNet

>pai:PAE2453 thymidine kinase; K00857 thymidine kinase [EC:2.7.1.21] (A)
MLVVIVGPMFAGKTTELIRRVERYVIAGRRAIVFKPSLDVRYDASKVAAHNGLKFDAFVI
PPDKDGVEIIRKMGAEYDVVAVDEIQFFPVDLADALNQLANGRIVIAAGLNLDFRGEPFE
TTARAMAFADRVISLSAVCKLCGKPATRTQRLINGVPAPRHSPRILIGGNESYEARCRRH
YVIPP

BLAST