GenomeNet

>pai:PAE3416 K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] | (GenBank) conserved hypothetical protein (A)
MYIPCLMCTQHPDSTVKITAGEEVDEAVVAFLAYGCDEVMVDYEGKATPYSQPRDVASKA
LALGLPLGERFFITPRVPNPRLEDFERSMLSLEAAVLANSYSQRAAGVQAVKWVVLPMTE
DVETMAFVYKALDMKARDLAELNAVKRDSSIELIPLVEDAMRQIKIESFIKALFRTAAQS
GRILEHMRIFLGISDSAVRHGHMASALAMVKALGQISEINRDGEFKISPIVGMGSPPFRG
GLNNPHLAVPEAAQYAGYKTATIQSAVRYDVSYAEYQKVREAILSVYTPRRLHVEEAWIT
KASELYREAIRPYIGKIAELANAIPSTRDRVSWREYGRVIEGVEWRVPRAIVYTATWYFA
GVPPTLLDARFIAWAYKNDLLDDVLRALPATVEEWKFESRFYSRERAEKTLGGEIVKDID
NAFDILGIKPEPDRTYITLLNSADTQPHAIALGRIRGFLG

BLAST