GenomeNet

>pai:PAE3428 hypothetical protein; K07405 alpha-amylase [EC:3.2.1.1] (A)
MEVVFFFEVHQPRRLRPDLYRVFPRRPGDLDVFYDELNEHIFRRVAERVYRKATRIILDV
AREVPGLRVTYSVSGLALEQFRKWAPDVLELFRELVAREVAEFVAQTYYHSLAWFVDKGE
FREQVEMQAKAVEELIGYKARAAENTEFIYNNDVACYLYSLGFSTVVTEGVDWVLGWRSP
NYVYKAWGCDAKVLVRNYRLSDDIGFRFGARWWDQWPLTADKYATWLEATPGDVVLIAVD
YETFGEHHWPESGIYDFLKWLPREIAKRPRLSFATVSEAASKHAPRDIYDVPPWATISWA
DERDLSAWLGNELQRNAFTLLKWLYPYARAVGEEALRLWRELSTSDHFYYQATKSGPAGE
VHSYFSPYGSAHKAHDIYMAALTSLLVLIRESWSLEAAERLVLDDERCFYGQGIRICSIR
ELRRLGKDVKEKYRGDLIRWLVNVFMISVEEALRLLG

BLAST