GenomeNet

>pai:PAE3428 K07405 alpha-amylase [EC:3.2.1.1] | (GenBank) conserved hypothetical protein (A)
MEVVFFFEVHQPRRLRPDLYRVFPRRPGDLDVFYDELNEHIFRRVAERVYRKATRIILDV
AREVPGLRVTYSVSGLALEQFRKWAPDVLELFRELVAREVAEFVAQTYYHSLAWFVDKGE
FREQVEMQAKAVEELIGYKARAAENTEFIYNNDVACYLYSLGFSTVVTEGVDWVLGWRSP
NYVYKAWGCDAKVLVRNYRLSDDIGFRFGARWWDQWPLTADKYATWLEATPGDVVLIAVD
YETFGEHHWPESGIYDFLKWLPREIAKRPRLSFATVSEAASKHAPRDIYDVPPWATISWA
DERDLSAWLGNELQRNAFTLLKWLYPYARAVGEEALRLWRELSTSDHFYYQATKSGPAGE
VHSYFSPYGSAHKAHDIYMAALTSLLVLIRESWSLEAAERLVLDDERCFYGQGIRICSIR
ELRRLGKDVKEKYRGDLIRWLVNVFMISVEEALRLLG

BLAST