GenomeNet

>paj:PAJ_3369 K02358 elongation factor Tu | (GenBank) tufA; domain III of elongation factor (EF) TufA (A)
MAKEQFQRNKLHVNVGTIGHVDHGKTTLTAAITTVLAKTNGGQARAFDQIDSTPEEKARG
ITINTAHVEYETPSRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRDLLSQYDFPGDDTPIVRGSALKALE
GNPEWEEKIVELAGHLDNYIPDPVRAIDMPFLLPIEDVFSISGRGTVVTGRVERGIVKVG
DEVEIVGIKDTAKSTCTGVEMFRKLLDQGQAGENCGVLLRGIKREDIQRGQVLAKPGSIK
PHTKFESEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGSVELPEGVEMVMPGDNIKMV
VTLIHPIAMDEGLRFAIREGGRTVGAGVVAKVIA

BLAST