GenomeNet

>pale:102880919 F13A1; coagulation factor XIII, A1 polypeptide; K03917 coagulation factor XIII A1 polypeptide [EC:2.3.2.13] (A)
MSGTPGTTFGGRRAVPPNNSNAAENELSTVELQSLVPRGFNPQDYLNVTGVHLFKERWDT
NKIDHHTDKYDSNKLIVRRGQSFYIQIDFNRPYEPRRDLFRVEYVIGRYPQENKGTYVPV
PIVSELQRGKWGAKVVTRDDRSVRLSIQSSPKCIVGKFRMYIAVWTPYGIIRTSRNPETD
TYILFNPWCEEDAVYLDDDKEREEYVLNDIGVIFYGDFNNIKSRSWSYGQFEDGILDACL
YMMDRAQMDLSGRGNPIKVSRVGSAMVNSKDDEGVLVGSWDNIYAYGVPPSAWTGSIDIL
LEYQSSQNPVRYGQCWVFAGVFNTFLRCLGIPARVVTNYFSAHDNDANLQMDIFLEEDGN
VNSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQAVDSTPQENSDGMYRCGPASVQAIKH
GHVCFQFDAPFVFAEVNSDLVYITAKKDGTHVVEAVDTTHIGKLIVTKQIGGDDMKDITD
TYKFQEGQKEERLALETALMYGVKKPLNTESVIKPKSDVVMDFEVENAVLGKDFKVNITF
QNNSPNSHTISAYLSGNITFYTGVSKEEFKKETFDVTLEPLSIKEEEVLVRAGEYMGQLL
EQASLQFFVTARVDKTGDILAKQKSTVLTIPKVNIKVRGPKMVGSDMVVTVEFTNPLKET
LQNVWIHLDGPGVIKPKRKLFREIQPNSTVQWEEVCRPWVSGHRKLIASMTSDSLRHVYG
ELDLQIQRQPSM

BLAST