GenomeNet

>pam:PANA_2090 tdk; Tdk; K00857 thymidine kinase [EC:2.7.1.21] (A)
MVKSALFFHRIRESAQMAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTLVYTAEIDNRF
GAGKVSSRIGLSSPAVLYNAASQLDVEIAQEHARQPVHCVLVDESQFLTREQVKALSDVV
DNLDIPVLCYGLRTDFLGELFTGSQYLLAWADKLVELKTVCHCGRKAGMVLRLDSDGKPF
REGEQVVIGGNERYISVCRKHYKKAIEQGCLQAIHGAQTPVGNK

BLAST