GenomeNet

>pan:PODANSg050 hypothetical protein; K06101 histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43] (A)
MATDMAATIATDVATSSIAAGLGCVIMSESSFSATPTDDSSNAASLSSTPPTTCTPDSMS
LASEPDATKPASMADATIEAVIPILENEAAADDNQQQQQPGELSPVGQAIVVAEPLPSTE
SLSTGRPRRARASLPVYNLSQLSGTDKRRRRVAGQGVQENRRRTIAGDAGGEADANRSTG
IDVLALGGSVSGTSTPKGARISSKTKPIPVQAPIVTRRATRQSGAPVETLATKVAALGRK
GRKSAQSLGRISRELMRLQDTNEFAHIDTRPVKYTVWSNGKYVDVDPAAEPPRKKTKVDG
KPKTETSKERATTEPSEPVRPPVKQRRVKQWHRKGLYAGQETPTDITQGLTTQEKKQLAQ
IPELLKPVKANKTLPLPMYNGLRMLIHGRDFKLPFDVCNPLPPGQPKPPAYRTIAKNRFV
GDAAAYWKKSPHFEDFSSKCVCKPEDGCAEDCQNRIMLYECDDTNCNAGREFCQNRAFQD
LQERTKKGGRFRVGVEVLKTSDRGYGVRSTRCFEPNQIIMEYTGEIITEEECERRMNEKY
KDNECYYLMSFDQNMIIDATTGSMARFVNHSCSPNCRMIKWIVSGQPRMALFAGDKPIMT
GDELTYDYNFDPFSAKNVQKCLCGSANCRGVLGPKPKEVKPPKPAKQEKKTARGSIKAGK
RKLKELLVGAEDEASGGNAAKKRKVQPAAGVKKTLTAAAKGAAKTAAAKGKGLARGVSKS
ASTAIKRSVSGTISLGASALKSTKGAGVKKTTTTTQRKVTSVGLTKTFGKRGVKTTTTTT
TKIKLSAKSTSSKATIVAAGPKPTPKKPAAGAKASTPASASASAASARKRTPSRKALEAS
TPDAGNTSVKGTSASSDVKAKVTTTTTTTAAVKLKQTKIKFVPKANAVAAAAAE

BLAST