GenomeNet

>pan:PODANSg09787 K06067 histone deacetylase 1/2 [EC:3.5.1.98] | (RefSeq) hypothetical protein (A)
MDPLTSALSNLREPRRRRGIGELPSSLVAAAHGLSAEHQLFPHTQNGGADFDSPTFLLSH
GSERTYIKYEDDTRINLLNWPSHPGRAKLDWDSSRDPDPGFEPIPFCPPLLSPIRFLPSS
REHEHHELDELCETKETPPQHTFSSIRFATMSNSNSTDPAGVERTRPLFEVVKNDKKRVA
YFYDSDIGNYAYVTGHPMKPHRIRLAHSLVMNYNVYKFLEIYRAKPAVTSEMTQFHTDEY
IEFLQKVTPDNMDSFMREQGKYNVGDDCPVFDGLFEFCGISAGGSMEGAARLNREKCDIA
INWAGGLHHAKKSEASGFCYVNDIVLAILELLRFKKRVLYIDIDVHHGDGVEEAFYTTDR
VMTVSFHKYGEYFPGTGELRDIGIGTGKHYAVNFPLRDGIDDVAYETIFEPVITNVMQYY
QPEAVVLQCGGDSLSGDRLGCFNLSMRGHANCVNFVRGFNLPTLVLGGGGYTMRNVARTW
AYETGRLVGVEMDRVLPFNEYYEYYGPDYELDVRNSNMENANSYEYLEKIKIQVIENLKR
TAPVPSVQMQDVPRQSMGVSDDQDDEMDDLDEDENKDVRMTQRQWEKRVERQDEYEDSDD
EDMAAANGVFKLNGRTRQETNFRDTKEDDTMEVDSGVATPAEQPVEITENDDTMIDEALA
EIAAEAEAEAQVKEPAATETAPEAPTAAVDGDGDVDMGEVTESKAAETVIKTEDVEEPVP
AKQDDSQSTAVVSPKKTTEVAAQPSRTSKSPEPAVAADKQTESVPEASEVVPPTTTQDNT
TNS

BLAST