GenomeNet

>pan:PODANSg09944 hypothetical protein; K00844 hexokinase [EC:2.7.1.1] (A)
MSSGSFVEVPKDLLKEIKRLEELFTVDTAKLKQITDHFVNELEKGLSKEGGTIPMNPTWV
MSFPTGYETGTYLALDMGGTNLRVCQITLTEQKSEFDIIQSKYRMPEELKTGVAEDLWEY
IAECLLQFIQTHHGDVAKLDKLPLGFTFSYPATQNYIDEGILQRWTKGFDIDGVEGRNVV
PMFEKALQERGVPIKLTALINDTTGTLIASAYTDTKMKIGCIFGTGCNAAYMEDCGSIPK
LAHLNLPPDTPMAINCEWGAFDNELKVLPRTPYDESIDTDSPRPGQQAFEKMIAGLYLGE
IFRLIMVDLHDNHNVNIFAGQDIGKLRRPYTLDSSFLSAIEDDPFENLSETRELFQNQLG
IDPNPSELELIRRAAELIGTRAARLSACGVAAISKKKGYKECHVGADGSVFNKYPHFKKR
GAAALREILDWPAKADPNDDDPIEILAAEDGSGVGAALIAALTLERVKKGNMHGILHPEN
FH

BLAST