GenomeNet

>pan:PODANSg1229 hypothetical protein (A)
MSDYNGNGHKASNGTGVTALNGSSSSHGSSSAHQSREGMELVASQAKPRPTPLDLKPTGA
NRAGVANAFERYGQVMQSSVAPLPNQHGADTFSRSKKWGKLRDDVKQLRLADYKTLLGVV
KAKVKGEKIKDDKTMAMEKVIQLVSNLPSNSKTRTELTNSFLSELWYTLEHPPSMYVGEK
FQYRQADGSYNNVMFPQLGAAGTSYSRSVAANVVRQGALPDPNLIFESVMKRTEYTEHPN
NVSSILWYWASIIIHDLFWTDYRDMSKSKTSSYLDLSPLYGSNQDMQDTIRTFKDGKIKP
DCFADKRLLGMPPGVGVFLIMFNRVHNHVAENLARINEDGRFSPPSPNLEGEKKEAAWKK
YDNDLFQHARLITSGLYINITLLDYVRNIVNLNRVDTTWTLDPRVETGINVDTKEGAERG
TGNVCSAEFNLCYRWHSCISAKDDKWIQDFYYDLFKKPGKDLSIHELIMGFGKFEGMIPD
DPAERPFNKFQRGPDGKFNDDDLVNCISDAIEDPAGSFGARNVPESMRAVEILGIIQGRR
WNVAGLNEFRKHFGLKPYEKFEDINSDPGVAESLRRLYDHPDFVELYPGLVAEERKEPMV
PGVGIAPTYTISRVVLSDAVCLVRGDRHYTIDYTPRNLTNWGFNEVQYDLNINHGCVFYK
LFLRAFPNHFKYNSVYAHYPMVTPSENSKILKDLKRAHLFDFSRPGRIATPTEVTSYDGA
QRIFAAEDKFKSTWNAGVAGIRAKASPELSGDAAVHDRHRTTASRSLFTPELGTQIKAFY
ESLTDKLLTTKSYTLVPGSKFADLVRDIANIVPTHFAASVFGLPLTTKENRKGIYTEHEL
YAVLQIIASALFVDSEPVKLFPVVEAAKTVAGQLGTLVDKTVKSPKAAKNSVLNTFGVNF
IKELKKAGLATHDITWNHVLPTAAALASSQGELFTQAVDYYLSPEGAAHVADITAIASQP
SSSQNDALLLGYVLEGIRLSGSARSHFEATTAGTVTASNGTELQIQPGSKVTINSSTASR
DAAYFPEPETVNPRRPLDKYIHFDAGPHAFLGKEISQIALTEMFRALFKRKNVRRAPGPQ
GELKKVPRADGNGVDYLREDWGALTPFPVTMKVMWDEV

BLAST