GenomeNet

>pan:PODANSg4666 hypothetical protein; K11429 histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43] (A)
MPPRSQAQGKKKLTLAQLAAYDDILTDALIDHTYYWTTIPKNRTSYHPSRGVREEEIAKL
IQTHLIINSDLKTAEEKLLATDGLKRFYNGLKTSKEKDDFKAHMRRYMSTYLPDCPFEVN
ATNRYTIVTYEASIVARRFIRRNETIKYLAGIQVTITPEEEADMASRKKDFSLVVSSRSK
STSLFMGPARFANHDCDANARLVTCGQAGIEIIACRDIGVGEEITVSYSESYFGEDNCEC
LCQTCEARQVNGWQQDEGGTSVKRSIEDDLAASQGYSFRRRLRDESVAGSGSRTPSVTPD
IRPRVLKKRGSQMVLSDRQSTAESTEGSGPGRKRGAAALGTPPITPAKRLKTMQYDLPPT
TSGSPISRSSSESELSRSPLASEAGSANLTDVTTPASDSADGLILSPEPTPIKQVIEILR
NEQPTAEIDVQQLPGSISPVPQKSYGFPTILPTTEVTPPAEELNKTEATKATPPVEEVVP
VPPLSDAAAPTTPVGKAKGSKKRQAAQQRSPPPAQKRRVPGDYTLTPLLLSERETAWIHC
TNCNTAFVQKDAYFTRANCPRCERHSKLYGYVWPKTQSAGKNDKEERILDHRVINRFLDP
EDEARARGKKGWRAGSQRESTMDTEGGSNPPQRGRARIRESLVPKAEGATAAALDGVRRS
GRARRASAKVIGDA

BLAST