GenomeNet

>pan:PODANSg5625 K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] | (RefSeq) hypothetical protein (A)
MASSMAWRRLAAAPALPRALRTPTQRAFSTTRPAARVIANGPLRAKEASPFVSSKYPVID
HEYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHKDDW
RWHMYDTVKGSDWLGDQDAIHYMTREAPASIIELENYGCPFSRTEDGKIYQRAFGGQSKE
YGKGGQAYRCCAAADRTGHALLHTLYGQSLRHNTNYFIEYFAIDLIMQDGECRGVLAYNQ
EDGTLHRFLANNTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTG
IYGAGCLITEGARGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTMEIRDGRGVGA
EKDHIYLQLSHLPAEILAERLPGISETAGIFAGVDVRKQPIPVLPTVHYNMGGIPTRYTG
EVLTVDESGNDKVVPGLFACGEAACVSVHGANRLGANSLLDLVVFGRAVAHTIRDNFTPG
AKLKPVEADAGAAEIEMLDKIRTADGPKSTAEIRLAMQKTMQRDVSVFRTQESLDEGVEK
INQVDQTFSQVGIKDRSMIWNSDLVETLELRNLLTCAVQTATAAANRKESRGAHAREDYP
DRDDENWMKHTLTWQKPHGKVDLKYRRVIGTTLDENECKPVPPFKRVY

BLAST