GenomeNet

>pan:PODANSg6788 hypothetical protein; K00818 acetylornithine aminotransferase [EC:2.6.1.11] (A)
MSLRPTLRLAATASRRCCSLASTRLASTATVPKYKEITHPDIMPGSSKSQSLIDSTSPYM
VTTYSRPPIVFTKASGSLIWDAAGREYLDFTGGIAVNSLGHNDPQLCAIMADQATTLTHC
SNLYYNSWVGELSKKLVGLTREKGGMHDAAQVFVCNSGSEANEAGIKFARKVGKVVDPSG
QKVEIVSFRNAFHGRTMGSLSATPNPKYQEPFAPMVPGFRVGELNDIAGIDGLVTERTCS
VIVEPIQGEGGVTPAGDEFLVRLARRCREVGALVHYDEIQCGLGRTGQFWAHGHLPKEAH
PDILTTAKALGNGFPIGATIINERVGERIKVGDHGTTFGGNPLACRLACNIVERLGDEKL
LEGVKRKEKIFRETFERWRGEWPELVKEVRGKGLILGLQLSEDPAGIVKAARERGLLVIT
AGTNTLRFVPALTIEEGQIKEGLEKLENAIRATRE

BLAST