GenomeNet

>pan:PODANSg7447 hypothetical protein; K11419 histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43] (A)
YCMQSLGRVSSHQHQLTPRVPQLLHFEPNITTMADQKPPVAFIGLGAMGFGMATHLIKQG
YPVTGFDVWAPTLKRFEEAGGSTATTPAEAVLNKEHVVVMVATAQQAQTVLLDGPNAAVP
KLPQGAVVLLCSTVPCDYVQALQVQLNSIGRSDILLIDSPVSGGAARAADGTLSIMAGMS
AAALEKGRPLLAELSDPAKLYIVEGGIGAGSNMKMVHQVLAANQILGASEVMGFAERLGL
DLAKAQKAVLESDAWNFMFEHRTPRIFTEFQPVASAVQIIVKDTSIITSEGRRSSFATPM
TSAAEQIYFTAVGRGWAMDDDSSLVRLYTEGNGKVGPVYGTAESEEDKTALVLALMRGIL
LCAAAESLAFAHTVSLDLDQVLDLCVNAAGGSKVLEKLGPAIIKELGGAGDASSGESSLE
DVFSGLSAAVEEAQRIKTPLYLGTQALSILQRVTQSKGTGSAGVVVKEGYSPHQQNKPAC
PTLYCSIPIPAPSRVFSSQHASHDQISPRASSTPVEQPHQLPKMEEAMKQHFFHHGKPDT
DPSEAEKCHWCQIRSFKTHKKLPITIVNEAKGDERKEVLNPDFKFIDHSIPSDDVPIAGA
SFRTGCNCADDEQCMYSTCECLDEMAPDSDEDMSDAPPARGRRIQKFQYYHSGTKAGLLK
SRILDSREPIYECHDGCSCSKNCPNRVVERGRTVPLQIFRTKNRGWGVKCPVDIKKGQFV
DKYLGEIITSEEANRRRAESTVSDKKDVYLFALDKFSDPDSPDPLLRAPPFEVDGEWMSG
PTRFINHSCDPNMRIFARVGDAVDKHVHDLALFAIRDIPAGEELTFDYVDGGLAEEDAGG
LVPDDKKKDMTKCLCGTKKCRGFLW

BLAST